AGPAT2 Antibody
| Name | AGPAT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88499 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AGPAT2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AGPAT2 |
| Supplier Page | Shop |
Product images
![Western Blot: AGPAT2 Antibody [NBP1-88499] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401930)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20941_AGPAT2%2520Antibody-Western%2520Blot-NBP1-88499-img0005.jpg)
Western Blot: AGPAT2 Antibody [NBP1-88499] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401930)
![Immunocytochemistry/Immunofluorescence: AGPAT2 Antibody [NBP1-88499] - Staining of human cell line U-251 MG shows positivity in centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20942_AGPAT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88499-img0004.jpg)
Immunocytochemistry/Immunofluorescence: AGPAT2 Antibody [NBP1-88499] - Staining of human cell line U-251 MG shows positivity in centrosome.
![Immunohistochemistry-Paraffin: AGPAT2 Antibody [NBP1-88499] - Staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/20943_AGPAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88499-img0002.jpg)
Immunohistochemistry-Paraffin: AGPAT2 Antibody [NBP1-88499] - Staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells.