CARD14 Antibody
| Name | CARD14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88598 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCELQKERDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CARD14 Protein |
| Description | Rabbit Polyclonal |
| Gene | CARD14 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CARD14 Antibody [NBP1-88598] Staining of human cell line U-251MG shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/21021_CARD14%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88598-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CARD14 Antibody [NBP1-88598] Staining of human cell line U-251MG shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: CARD14 Antibody [NBP1-88598] - Staining of human pancreas shows strong cytoplasmic positivity with a ganular pattern in exocrine cells while islet cells were negative.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/21022_CARD14%2520Antibody-Immunohistochemistry-Paraffin-NBP1-88598-img0002.jpg)
Immunohistochemistry-Paraffin: CARD14 Antibody [NBP1-88598] - Staining of human pancreas shows strong cytoplasmic positivity with a ganular pattern in exocrine cells while islet cells were negative.
Product References
Familial pityriasis rubra pilaris is caused by mutations in CARD14. - Familial pityriasis rubra pilaris is caused by mutations in CARD14.
Fuchs-Telem D, Sarig O, van Steensel MA, Isakov O, Israeli S, Nousbeck J, Richard K, Winnepenninckx V, Vernooij M, Shomron N, Uitto J, Fleckman P, Richard G, Sprecher E. Am J Hum Genet. 2012 Jul 13;91(1):163-70.
Increased epidermal expression and absence of mutations in CARD14 in a series of - Increased epidermal expression and absence of mutations in CARD14 in a series of
Eytan O, Qiaoli L, Nousbeck J, van Steensel MA, Burger B, Hohl D, Taieb A, Prey S, Bachmann D, Avitan-Hersh E, Jin Chung H, Shemer A, Trau H, Bergman R, Fuchs-Telem D, Warshauer E, Israeli S, Itin PH, Sarig O, Uitto J, Sprecher E. Br J Dermatol. 2014 May;170(5):1196-8.