USH1G Antibody

Name USH1G Antibody
Supplier Novus Biologicals
Catalog NBP1-89076
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
Purity/Format Immunogen affinity purified
Blocking Peptide USH1G Protein
Description Rabbit Polyclonal
Gene USH1G
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.