USH1C Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-89190
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: USH1C Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: USH1C
• Conjugate: Unconjugated

Product images

Western Blot: USH1C Antibody [NBP1-89190] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: USH1C Antibody [NBP1-89190] - Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.

Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89190] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.

Western Blot: USH1C Antibody [NBP1-89190] - Analysis in human cell line CACO-2.