ATP12A Antibody
| Name | ATP12A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88886 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMGLSSTR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ATP12A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATP12A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ATP12A Antibody [NBP1-88886] - Analysis in control (vector only transfected HEK293T lysate) and ATP12A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15434_ATP12A%2520Antibody-Western%2520Blot-NBP1-88886-img0006.jpg)
Western Blot: ATP12A Antibody [NBP1-88886] - Analysis in control (vector only transfected HEK293T lysate) and ATP12A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunohistochemistry-Paraffin: ATP12A Antibody [NBP1-88886] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15435_ATP12A-Antibody-Immunohistochemistry-Paraffin-NBP1-88886-img0005.jpg)
Immunohistochemistry-Paraffin: ATP12A Antibody [NBP1-88886] - Staining of human kidney shows strong membranous positivity in cells in tubules.