METTL18 Antibody
| Name | METTL18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88869 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | METTL18 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | METTL18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: METTL18 Antibody [NBP1-88869] - Analysis in control (vector only transfected HEK293T lysate) and METTL18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6227_METTL18-Antibody-Western-Blot-NBP1-88869-img0006.jpg)
Western Blot: METTL18 Antibody [NBP1-88869] - Analysis in control (vector only transfected HEK293T lysate) and METTL18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: METTL18 Antibody [NBP1-88869] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6228_METTL18%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88869-img0008.jpg)
Immunocytochemistry/Immunofluorescence: METTL18 Antibody [NBP1-88869] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: METTL18 Antibody [NBP1-88869] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6229_METTL18-Antibody-Immunohistochemistry-Paraffin-NBP1-88869-img0007.jpg)
Immunohistochemistry-Paraffin: METTL18 Antibody [NBP1-88869] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.
![Immunohistochemistry-Paraffin: METTL18 Antibody [NBP1-88869] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6230_METTL18-Antibody-Immunohistochemistry-Paraffin-NBP1-88869-img0002.jpg)
Immunohistochemistry-Paraffin: METTL18 Antibody [NBP1-88869] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.