NDUFB8 Antibody
| Name | NDUFB8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88859 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NDUFB8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NDUFB8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NDUFB8 Antibody [NBP1-88859] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24912_NDUFB8%2520Antibody-Western%2520Blot-NBP1-88859-img0005.jpg)
![Immunohistochemistry-Paraffin: NDUFB8 Antibody [NBP1-88859] - Staining of human heart muscle shows strong granular positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24913_NDUFB8-Antibody-Immunohistochemistry-Paraffin-NBP1-88859-img0006.jpg)