ABHD13 Antibody

Name ABHD13 Antibody
Supplier Novus Biologicals
Catalog NBP1-88978
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:KSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFP
Purity/Format Immunogen affinity purified
Blocking Peptide ABHD13 Protein
Description Rabbit Polyclonal
Gene ABHD13
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.