NAPE-PLD Antibody

Name NAPE-PLD Antibody
Supplier Novus Biologicals
Catalog NBP1-88248
Prices $129.00, $419.00
Sizes 25 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE
Purity/Format Immunogen affinity purified
Blocking Peptide NAPE-PLD Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene NAPEPLD
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.