AIDA Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-88323
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: AIDA Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: AIDA
• Conjugate: Unconjugated

Product images

Western Blot: AIDA Antibody [NBP1-88323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: AIDA Antibody [NBP1-88323] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubules.

Immunohistochemistry-Paraffin: AIDA Antibody [NBP1-88323] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.