RSPH3 Antibody
| Name | RSPH3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84245 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IIEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILEGELFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYEELRN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RSPH3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RSPH3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RSPH3 Antibody [NBP1-84245] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15401_RSPH3-Antibody-Western-Blot-NBP1-84245-img0005.jpg)
Western Blot: RSPH3 Antibody [NBP1-84245] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: RSPH3 Antibody [NBP1-84245] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15402_RSPH3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84245-img0006.jpg)
Immunocytochemistry/Immunofluorescence: RSPH3 Antibody [NBP1-84245] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: RSPH3 Antibody [NBP1-84245] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15403_RSPH3-Antibody-Immunohistochemistry-Paraffin-NBP1-84245-img0002.jpg)
Immunohistochemistry-Paraffin: RSPH3 Antibody [NBP1-84245] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.