PCYT1A Antibody

Name PCYT1A Antibody
Supplier Novus Biologicals
Catalog NBP1-84366
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:DGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVR
Purity/Format Immunogen affinity purified
Blocking Peptide PCYT1A Protein
Description Rabbit Polyclonal
Gene PCYT1A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.