Tight Junction Protein 1 Antibody
| Name | Tight Junction Protein 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85047 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Tight Junction Protein 1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TJP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/100_Tight%2520Junction%2520Protein%25201%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0008.jpg)
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cell junctions.
![Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows distinct membranous positivity in cells in glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/101_Tight-Junction-Protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85047-img0005.jpg)
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows distinct membranous positivity in cells in glomeruli.
![Immunocytochemistry: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/102_Tight-Junction-Protein-1-Antibody-Immunocytochemistry-NBP1-85047-img0007.jpg)
Immunocytochemistry: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. Image from verified customer review.
![Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/103_Tight-Junction-Protein-1-Antibody-Simple-Western-NBP1-85047-img0006.jpg)
Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.