Hikeshi Antibody
| Name | Hikeshi Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83174 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Hikeshi Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C11orf73 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Hikeshi Antibody [NBP1-83174] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25560_Hikeshi-Antibody-Western-Blot-NBP1-83174-img0008.jpg)
Western Blot: Hikeshi Antibody [NBP1-83174] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunohistochemistry-Paraffin: Hikeshi Antibody [NBP1-83174] - Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25561_Hikeshi-Antibody-Immunohistochemistry-Paraffin-NBP1-83174-img0002.jpg)
Immunohistochemistry-Paraffin: Hikeshi Antibody [NBP1-83174] - Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.