TRAPPC2L Antibody
| Name | TRAPPC2L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83172 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRAPPC2L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRAPPC2L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TRAPPC2L Antibody [NBP1-83172] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21825_TRAPPC2L-Antibody-Western-Blot-NBP1-83172-img0008.jpg)
Western Blot: TRAPPC2L Antibody [NBP1-83172] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Immunocytochemistry/Immunofluorescence: TRAPPC2L Antibody [NBP1-83172] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21826_TRAPPC2L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83172-img0009.jpg)
Immunocytochemistry/Immunofluorescence: TRAPPC2L Antibody [NBP1-83172] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.
![Immunohistochemistry-Paraffin: TRAPPC2L Antibody [NBP1-83172] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21827_TRAPPC2L-Antibody-Immunohistochemistry-Paraffin-NBP1-83172-img0002.jpg)
Immunohistochemistry-Paraffin: TRAPPC2L Antibody [NBP1-83172] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
![Western Blot: TRAPPC2L Antibody [NBP1-83172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21828_TRAPPC2L-Antibody-Western-Blot-NBP1-83172-img0006.jpg)
Western Blot: TRAPPC2L Antibody [NBP1-83172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunocytochemistry/Immunofluorescence: TRAPPC2L Antibody [NBP1-83172] - Staining of human cell line A-431 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21829_TRAPPC2L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83172-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TRAPPC2L Antibody [NBP1-83172] - Staining of human cell line A-431 shows positivity in cytoplasm.