GGN Antibody
| Name | GGN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83499 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SGAISYAEVLKQGPLPPGAARPLGEVSRGAQEAEGGDGDGEGCSGPPSAPASQARALPPPPYTTFPGSKPKFDWVSAPDGPERHFRFNGAG |
| Description | Rabbit Polyclonal |
| Gene | GGN |
| Supplier Page | Shop |
Product images
![Western Blot: GGN Antibody [NBP1-83499] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22526_GGN%2520Antibody-Western%2520Blot-NBP1-83499-img0005.jpg)
Western Blot: GGN Antibody [NBP1-83499] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: GGN Antibody [NBP1-83499] - Staining of human cell line A-431 shows positivity in nuclear membrane & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22527_GGN-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83499-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GGN Antibody [NBP1-83499] - Staining of human cell line A-431 shows positivity in nuclear membrane & cytoplasm.
![Immunohistochemistry-Paraffin: GGN Antibody [NBP1-83499] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22528_GGN-Antibody-Immunohistochemistry-Paraffin-NBP1-83499-img0002.jpg)
Immunohistochemistry-Paraffin: GGN Antibody [NBP1-83499] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.