Centaurin beta 2 Antibody
| Name | Centaurin beta 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84543 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Centaurin beta 2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ACAP2 |
| Supplier Page | Shop |
Product images
![Western Blot: Centaurin beta 2 Antibody [NBP1-84543] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22706_Centaurin%2520beta%25202%2520Antibody-Western%2520Blot-NBP1-84543-img0005.jpg)
Western Blot: Centaurin beta 2 Antibody [NBP1-84543] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: Centaurin beta 2 Antibody [NBP1-84543] - Staining of human cell line U-2 OS shows positivity in nucleoli & plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22707_Centaurin-beta-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84543-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Centaurin beta 2 Antibody [NBP1-84543] - Staining of human cell line U-2 OS shows positivity in nucleoli & plasma membrane.
![Immunohistochemistry-Paraffin: Centaurin beta 2 Antibody [NBP1-84543] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22708_Centaurin-beta-2-Antibody-Immunohistochemistry-Paraffin-NBP1-84543-img0001.jpg)
Immunohistochemistry-Paraffin: Centaurin beta 2 Antibody [NBP1-84543] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.