RRP15 Antibody
| Name | RRP15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84522 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RRP15 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RRP15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RRP15 Antibody [NBP1-84522] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-493](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13089_RRP15-Antibody-Western-Blot-NBP1-84522-img0006.jpg)
Western Blot: RRP15 Antibody [NBP1-84522] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-493
![Immunocytochemistry/Immunofluorescence: RRP15 Antibody [NBP1-84522] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13090_RRP15%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84522-img0007.jpg)
Immunocytochemistry/Immunofluorescence: RRP15 Antibody [NBP1-84522] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
![Immunohistochemistry-Paraffin: RRP15 Antibody [NBP1-84522] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13091_RRP15-Antibody-Immunohistochemistry-Paraffin-NBP1-84522-img0001.jpg)
Immunohistochemistry-Paraffin: RRP15 Antibody [NBP1-84522] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.