TTC15 Antibody
| Name | TTC15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84500 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AFLHLGQNNFAEAHRFFTEILRMDPRNAVANNNAAVCLLYLGKLKDSLRQLEAMVQQDPRHYLHESVLFNLTTMYELESSRSMQKKQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TTC15 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRAPPC12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TTC15 Antibody [NBP1-84500] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-611](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16434_TTC15%2520Antibody-Western%2520Blot-NBP1-84500-img0005.jpg)
Western Blot: TTC15 Antibody [NBP1-84500] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-611
![Immunocytochemistry/Immunofluorescence: TTC15 Antibody [NBP1-84500] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16435_TTC15-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84500-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TTC15 Antibody [NBP1-84500] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
![Immunohistochemistry-Paraffin: TTC15 Antibody [NBP1-84500] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16436_TTC15-Antibody-Immunohistochemistry-Paraffin-NBP1-84500-img0002.jpg)
Immunohistochemistry-Paraffin: TTC15 Antibody [NBP1-84500] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.