Mitochondrial fission regulator 1 Antibody
| Name | Mitochondrial fission regulator 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84480 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEATSERVLFGPHMLKPTGKMKALIENVSD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Mitochondrial fission regulator 1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MTFR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Mitochondrial fission regulator 1 Antibody [NBP1-84480] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-340](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12961_Mitochondrial-fission-regulator-1-Antibody-Western-Blot-NBP1-84480-img0006.jpg)
Western Blot: Mitochondrial fission regulator 1 Antibody [NBP1-84480] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-340
![Immunocytochemistry/Immunofluorescence: Mitochondrial fission regulator 1 Antibody [NBP1-84480] - Staining of human cell line A-431 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12962_Mitochondrial-fission-regulator-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84480-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Mitochondrial fission regulator 1 Antibody [NBP1-84480] - Staining of human cell line A-431 shows positivity in mitochondria.
![Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody [NBP1-84480] - Staining of human liver shows strong cytoplasmic positivity(granular pattern) in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12963_Mitochondrial-fission-regulator-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84480-img0002.jpg)
Immunohistochemistry-Paraffin: Mitochondrial fission regulator 1 Antibody [NBP1-84480] - Staining of human liver shows strong cytoplasmic positivity(granular pattern) in hepatocytes.