FGF18 Antibody

Name	FGF18 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-84690
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGED
Purity/Format	Immunogen affinity purified
Blocking Peptide	FGF18 Protein
Description	Rabbit Polyclonal
Gene	FGF18
Supplier Page	Shop

Product images

Western Blot: FGF18 Antibody [NBP1-84690] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)

Western Blot: FGF18 Antibody [NBP1-84690] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)

Immunocytochemistry/Immunofluorescence: FGF18 Antibody [NBP1-84690] - Staining of human cell line U-251MG shows positivity in nucleoli & cytoplasm.

Immunohistochemistry-Paraffin: FGF18 Antibody [NBP1-84690] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.