ST7/LRP12 Antibody
| Name | ST7/LRP12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84771 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCATAY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ST7/LRP12 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRP12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST7/LRP12 Antibody [NBP1-84771] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17447_ST7-LRP12-Antibody-Western-Blot-NBP1-84771-img0005.jpg)
Western Blot: ST7/LRP12 Antibody [NBP1-84771] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: ST7/LRP12 Antibody [NBP1-84771] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17448_ST7-LRP12%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84771-img0006.jpg)
Immunocytochemistry/Immunofluorescence: ST7/LRP12 Antibody [NBP1-84771] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: ST7/LRP12 Antibody [NBP1-84771] - Staining of human pancreas shows moderate membranous positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17449_ST7-LRP12-Antibody-Immunohistochemistry-Paraffin-NBP1-84771-img0003.jpg)
Immunohistochemistry-Paraffin: ST7/LRP12 Antibody [NBP1-84771] - Staining of human pancreas shows moderate membranous positivity.