THEG Antibody
| Name | THEG Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85399 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:INWQVLKDRKGRCGKGYAWISPCKMSLHFCLCWPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPVWPIPRSSL |
| Description | Rabbit Polyclonal |
| Gene | THEG |
| Supplier Page | Shop |
Product images
![Western Blot: THEG Antibody [NBP1-85399] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413885)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22992_THEG%2520Antibody-Western%2520Blot-NBP1-85399-img0004.jpg)
Western Blot: THEG Antibody [NBP1-85399] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413885)
![Immunocytochemistry/Immunofluorescence: THEG Antibody [NBP1-85399] - Staining of human cell line U-2 OS shows positivity in plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22993_THEG-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85399-img0003.jpg)
Immunocytochemistry/Immunofluorescence: THEG Antibody [NBP1-85399] - Staining of human cell line U-2 OS shows positivity in plasma membrane.
![Immunohistochemistry-Paraffin: THEG Antibody [NBP1-85399] - Staining of human smooth muscle shows strong membranous positivity in smooth muscle cells while endothelial cells were distinctly stained.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/22994_THEG-Antibody-Immunohistochemistry-Paraffin-NBP1-85399-img0002.jpg)
Immunohistochemistry-Paraffin: THEG Antibody [NBP1-85399] - Staining of human smooth muscle shows strong membranous positivity in smooth muscle cells while endothelial cells were distinctly stained.