PPAPDC1A Antibody
| Name | PPAPDC1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14545 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PPAPDC1A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPAPDC1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PPAPDC1A Antibody [NBP2-14545] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13700_PPAPDC1A-Antibody-Western-Blot-NBP2-14545-img0004.jpg)
Western Blot: PPAPDC1A Antibody [NBP2-14545] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: PPAPDC1A Antibody [NBP2-14545] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13701_PPAPDC1A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14545-img0005.jpg)
Immunocytochemistry/Immunofluorescence: PPAPDC1A Antibody [NBP2-14545] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: PPAPDC1A Antibody [NBP2-14545] - Staining of human cerebral cortex shows moderate nucleolar positivity in neuronal cells, neuropil was strongly stained.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13702_PPAPDC1A-Antibody-Immunohistochemistry-Paraffin-NBP2-14545-img0006.jpg)
Immunohistochemistry-Paraffin: PPAPDC1A Antibody [NBP2-14545] - Staining of human cerebral cortex shows moderate nucleolar positivity in neuronal cells, neuropil was strongly stained.