Lymphotoxin beta/TNFSF3 Antibody

Name Lymphotoxin beta/TNFSF3 Antibody
Supplier Novus Biologicals
Catalog NBP2-14207
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQG LGWETTKEQAFLTSGTQFSD
Purity/Format Immunogen affinity purified
Blocking Peptide Lymphotoxin beta/TNFSF3 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene LTB
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.