PPP1R36 Antibody
| Name | PPP1R36 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85888 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KYHQVDVRFPAEMQKHVGTLDSVPMPVVGILGEPRCLFNPHTLHPLDPEENTKSFGRYPSLMENNNMRIQDTLDLVMKTLSSHTSCPK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PPP1R36 Protein |
| Description | Rabbit Polyclonal |
| Gene | PPP1R36 |
| Supplier Page | Shop |
Product images
![Western Blot: PPP1R36 Antibody [NBP1-85888] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23242_PPP1R36%2520Antibody-Western%2520Blot-NBP1-85888-img0005.jpg)
Western Blot: PPP1R36 Antibody [NBP1-85888] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: PPP1R36 Antibody [NBP1-85888] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23243_PPP1R36-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85888-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PPP1R36 Antibody [NBP1-85888] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
![Immunohistochemistry-Paraffin: PPP1R36 Antibody [NBP1-85888] - Staining of human duodenum shows strong nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23244_PPP1R36-Antibody-Immunohistochemistry-Paraffin-NBP1-85888-img0002.jpg)
Immunohistochemistry-Paraffin: PPP1R36 Antibody [NBP1-85888] - Staining of human duodenum shows strong nuclear and cytoplasmic positivity in glandular cells.