CAPS2 Antibody
| Name | CAPS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85855 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGII |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CAPS2 Protein |
| Description | Rabbit Polyclonal |
| Gene | CAPS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CAPS2 Antibody [NBP1-85855] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5882_CAPS2-Antibody-Western-Blot-NBP1-85855-img0006.jpg)
Western Blot: CAPS2 Antibody [NBP1-85855] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: CAPS2 Antibody [NBP1-85855] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5883_CAPS2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85855-img0007.jpg)
Immunocytochemistry/Immunofluorescence: CAPS2 Antibody [NBP1-85855] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
![Immunohistochemistry-Paraffin: CAPS2 Antibody [NBP1-85855] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5884_CAPS2-Antibody-Immunohistochemistry-Paraffin-NBP1-85855-img0002.jpg)
Immunohistochemistry-Paraffin: CAPS2 Antibody [NBP1-85855] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
![Immunocytochemistry/Immunofluorescence: CAPS2 Antibody [NBP1-85855] - Staining of human cell line A-431 shows positivity in nucleus, nucleoli, cytoplasm and centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5885_CAPS2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85855-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CAPS2 Antibody [NBP1-85855] - Staining of human cell line A-431 shows positivity in nucleus, nucleoli, cytoplasm and centrosome.