UTP18 Antibody
| Name | UTP18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13511 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKN ASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UTP18 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UTP18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UTP18 Antibody [NBP2-13511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6826_UTP18-Antibody-Western-Blot-NBP2-13511-img0003.jpg)
Western Blot: UTP18 Antibody [NBP2-13511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: UTP18 Antibody [NBP2-13511] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6827_UTP18-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13511-img0004.jpg)
Immunocytochemistry/Immunofluorescence: UTP18 Antibody [NBP2-13511] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: UTP18 Antibody [NBP2-13511] - Staining of human cerebral cortex shows strong nucleolar positivity in neurons.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6828_UTP18-Antibody-Immunohistochemistry-Paraffin-NBP2-13511-img0001.jpg)
Immunohistochemistry-Paraffin: UTP18 Antibody [NBP2-13511] - Staining of human cerebral cortex shows strong nucleolar positivity in neurons.