TIM23 Antibody
| Name | TIM23 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13432 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTR |
| Description | Rabbit Polyclonal |
| Gene | TIMM23 |
| Supplier Page | Shop |
Product images
![Western Blot: TIM23 Antibody [NBP2-13432] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401917)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23448_TIM23-Antibody-Western-Blot-NBP2-13432-img0004.jpg)
Western Blot: TIM23 Antibody [NBP2-13432] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401917)
![Immunohistochemistry-Paraffin: TIM23 Antibody [NBP2-13432] - Staining of human uterus, pre-menopause shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23449_TIM23-Antibody-Immunohistochemistry-Paraffin-NBP2-13432-img0001.jpg)
Immunohistochemistry-Paraffin: TIM23 Antibody [NBP2-13432] - Staining of human uterus, pre-menopause shows moderate cytoplasmic positivity in glandular cells.