CAPZA3 Antibody
| Name | CAPZA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86631 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DIQSHGIIQNEAEYLRVVLLCALKLYVNDHYPKGNCNMLRKTVKSKEYLIACIEDHNYETGECWNGLWKSKW |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CAPZA3 |
| Supplier Page | Shop |
Product images
![Western Blot: CAPZA3 Antibody [NBP1-86631] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23494_CAPZA3%2520Antibody-Western%2520Blot-NBP1-86631-img0005.jpg)
Western Blot: CAPZA3 Antibody [NBP1-86631] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: CAPZA3 Antibody [NBP1-86631] - Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & cytoskeleton (microtubules).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23495_CAPZA3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86631-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CAPZA3 Antibody [NBP1-86631] - Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & cytoskeleton (microtubules).
![Immunohistochemistry-Paraffin: CAPZA3 Antibody [NBP1-86631] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23496_CAPZA3-Antibody-Immunohistochemistry-Paraffin-NBP1-86631-img0002.jpg)
Immunohistochemistry-Paraffin: CAPZA3 Antibody [NBP1-86631] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.