SLCO2A1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-13349
• Prices: $129.00, $419.00
• Sizes: 25 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMS SATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SLCO2A1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SLCO2A1
• Conjugate: Unconjugated

Product images

Western Blot: SLCO2A1 Antibody [NBP2-13349] - Analysis in human cell line EFO-21.

Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.

Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human prostate shows strong membranous positivity in endothelial cells.

Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human seminal vesicle shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli and endothelial cells.

Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.