CNRIP1 Antibody
| Name | CNRIP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86800 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CNRIP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CNRIP1 |
| Supplier Page | Shop |
Product images
![Western Blot: CNRIP1 Antibody [NBP1-86800] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23610_CNRIP1%2520Antibody-Western%2520Blot-NBP1-86800-img0005.jpg)
Western Blot: CNRIP1 Antibody [NBP1-86800] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: CNRIP1 Antibody [NBP1-86800] - Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23611_CNRIP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86800-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CNRIP1 Antibody [NBP1-86800] - Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: CNRIP1 Antibody [NBP1-86800] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/23612_CNRIP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86800-img0001.jpg)
Immunohistochemistry-Paraffin: CNRIP1 Antibody [NBP1-86800] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.