UBE2CBP Antibody
| Name | UBE2CBP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86757 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLELLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UBE2CBP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UBE3D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: UBE2CBP Antibody [NBP1-86757] - Staining of human cell line RH-30 shows localization to rods & rings.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/3966_UBE2CBP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86757-img0006.jpg)
![Immunohistochemistry-Paraffin: UBE2CBP Antibody [NBP1-86757] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/3967_UBE2CBP%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86757-img0007.jpg)