LTV1 Antibody
| Name | LTV1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86733 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ATGEEEGMDIQKSENEDDSEWEDVDDEKGDSNDDYDSAGLLSDEDCMSVPGKTHRAIADHLFWSEETKSRFTEYSM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LTV1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LTV1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: LTV1 Antibody [NBP1-86733] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25843_LTV1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86733-img0006.jpg)
Immunocytochemistry/Immunofluorescence: LTV1 Antibody [NBP1-86733] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: LTV1 Antibody [NBP1-86733] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25844_LTV1-Antibody-Immunohistochemistry-Paraffin-NBP1-86733-img0002.jpg)
Immunohistochemistry-Paraffin: LTV1 Antibody [NBP1-86733] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.