COL14A1 Antibody
| Name | COL14A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86877 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDLEKRKDPKPR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | COL14A1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | COL14A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: COL14A1 Antibody [NBP1-86877] - Analysis in human plasma.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22421_COL14A1-Antibody-Western-Blot-NBP1-86877-img0007.jpg)
Western Blot: COL14A1 Antibody [NBP1-86877] - Analysis in human plasma.
![Immunocytochemistry/Immunofluorescence: COL14A1 Antibody [NBP1-86877] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22422_COL14A1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86877-img0010.jpg)
Immunocytochemistry/Immunofluorescence: COL14A1 Antibody [NBP1-86877] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
![Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22423_COL14A1-Antibody-Immunohistochemistry-Paraffin-NBP1-86877-img0002.jpg)
Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.