Chondrolectin Antibody
| Name | Chondrolectin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86817 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Chondrolectin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CHODL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Chondrolectin Antibody [NBP1-86817] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13139_Chondrolectin-Antibody-Western-Blot-NBP1-86817-img0006.jpg)
Western Blot: Chondrolectin Antibody [NBP1-86817] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
![Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining of human testis shows cytoplasmic positivity in ductus seminiferous.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13140_Chondrolectin-Antibody-Immunohistochemistry-Paraffin-NBP1-86817-img0009.jpg)
Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining of human testis shows cytoplasmic positivity in ductus seminiferous.
![Western Blot: Chondrolectin Antibody [NBP1-86817] - Lane 1: Mouse liver tissue lysate. Lane 2: Rat liver tissue lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13141_Chondrolectin-Antibody-Western-Blot-NBP1-86817-img0005.jpg)
Western Blot: Chondrolectin Antibody [NBP1-86817] - Lane 1: Mouse liver tissue lysate. Lane 2: Rat liver tissue lysate.
![Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining of human small intestine shows strong cytoplasmic granular positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13142_Chondrolectin-Antibody-Immunohistochemistry-Paraffin-NBP1-86817-img0007.jpg)
Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining of human small intestine shows strong cytoplasmic granular positivity in glandular cells.
![Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13143_Chondrolectin-Antibody-Immunohistochemistry-Paraffin-NBP1-86817-img0008.jpg)
Immunohistochemistry-Paraffin: Chondrolectin Antibody [NBP1-86817] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.