IER5 Antibody
| Name | IER5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85935 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPEAAEPGQICCDKPV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IER5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IER5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26083_IER5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85935-img0011.jpg)
Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: IER5 Antibody [NBP1-85935] - Staining of human cerebral cortex shows moderate positivity in neuropil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26084_IER5-Antibody-Immunohistochemistry-Paraffin-NBP1-85935-img0007.jpg)
Immunohistochemistry-Paraffin: IER5 Antibody [NBP1-85935] - Staining of human cerebral cortex shows moderate positivity in neuropil.
![Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Staining of mouse caudate putamen shows weak synaptic-like immunoreactivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26085_IER5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85935-img0008.jpg)
Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Staining of mouse caudate putamen shows weak synaptic-like immunoreactivity.
![Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Staining of mouse hippocampus shows synaptic-like positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26086_IER5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85935-img0009.jpg)
Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Staining of mouse hippocampus shows synaptic-like positivity.
![Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Staining of mouse olfactory bulb shows weak labeling in the external plexiform layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26087_IER5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85935-img0010.jpg)
Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Staining of mouse olfactory bulb shows weak labeling in the external plexiform layer.
![Immunohistochemistry-Paraffin: IER5 Antibody [NBP1-85935] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/26088_IER5-Antibody-Immunohistochemistry-Paraffin-NBP1-85935-img0006.jpg)
Immunohistochemistry-Paraffin: IER5 Antibody [NBP1-85935] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.