KLHL17 Antibody
| Name | KLHL17 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85926 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AGAWESVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRTNKWVAASCMFTRRSSVGVAVLELLNFPPPSSPTLSVS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KLHL17 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KLHL17 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KLHL17 Antibody [NBP1-85926] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15437_KLHL17-Antibody-Western-Blot-NBP1-85926-img0006.jpg)
Western Blot: KLHL17 Antibody [NBP1-85926] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
![Immunocytochemistry/Immunofluorescence: KLHL17 Antibody [NBP1-85926] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15438_KLHL17-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85926-img0007.jpg)
Immunocytochemistry/Immunofluorescence: KLHL17 Antibody [NBP1-85926] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
![Immunohistochemistry-Paraffin: KLHL17 Antibody [NBP1-85926] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15439_KLHL17-Antibody-Immunohistochemistry-Paraffin-NBP1-85926-img0002.jpg)
Immunohistochemistry-Paraffin: KLHL17 Antibody [NBP1-85926] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.