SHFM3 Antibody
| Name | SHFM3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14013 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTH LGSDFPPGAGVLDVMYESPFTLLSCGYD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SHFM3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FBXW4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SHFM3 Antibody [NBP2-14013] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14632_SHFM3-Antibody-Western-Blot-NBP2-14013-img0004.jpg)
Western Blot: SHFM3 Antibody [NBP2-14013] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: SHFM3 Antibody [NBP2-14013] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14633_SHFM3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14013-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SHFM3 Antibody [NBP2-14013] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
![Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14634_SHFM3-Antibody-Immunohistochemistry-Paraffin-NBP2-14013-img0001.jpg)
Immunohistochemistry-Paraffin: SHFM3 Antibody [NBP2-14013] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.