FAM3C Antibody
| Name | FAM3C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13996 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEA RRLIADLGSTSITNLGFRDNWVFCG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM3C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM3C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM3C Antibody [NBP2-13996] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14794_FAM3C-Antibody-Western-Blot-NBP2-13996-img0004.jpg)
Western Blot: FAM3C Antibody [NBP2-13996] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: FAM3C Antibody [NBP2-13996] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14795_FAM3C%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13996-img0005.jpg)
Immunocytochemistry/Immunofluorescence: FAM3C Antibody [NBP2-13996] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
![Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human hippocampus shows strong granular cytoplasmic positivity in neurons.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14796_FAM3C-Antibody-Immunohistochemistry-Paraffin-NBP2-13996-img0001.jpg)
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13996] - Staining of human hippocampus shows strong granular cytoplasmic positivity in neurons.