C7orf29 Antibody

Name C7orf29 Antibody
Supplier Novus Biologicals
Catalog NBP1-86035
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:GKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSHSG
Purity/Format Immunogen affinity purified
Blocking Peptide C7orf29 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ZBED6CL
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.