EIF5 Antibody
| Name | EIF5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86184 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EIF5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EIF5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EIF5 Antibody [NBP1-86184] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13565_EIF5-Antibody-Western-Blot-NBP1-86184-img0005.jpg)
Western Blot: EIF5 Antibody [NBP1-86184] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: EIF5 Antibody [NBP1-86184] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13566_EIF5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86184-img0006.jpg)
Immunocytochemistry/Immunofluorescence: EIF5 Antibody [NBP1-86184] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
![Immunohistochemistry-Paraffin: EIF5 Antibody [NBP1-86184] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13567_EIF5-Antibody-Immunohistochemistry-Paraffin-NBP1-86184-img0001.jpg)
Immunohistochemistry-Paraffin: EIF5 Antibody [NBP1-86184] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
![Western Blot: EIF5 Antibody [NBP1-86184] - Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13568_EIF5-Antibody-Western-Blot-NBP1-86184-img0002.jpg)
Western Blot: EIF5 Antibody [NBP1-86184] - Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Western Blot: EIF5 Antibody [NBP1-86184] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13569_EIF5-Antibody-Western-Blot-NBP1-86184-img0003.jpg)
Western Blot: EIF5 Antibody [NBP1-86184] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
![Immunofluorescence: EIF5 Antibody [NBP1-86184] - Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13570_EIF5-Antibody-Immunofluorescence-NBP1-86184-img0004.jpg)
Immunofluorescence: EIF5 Antibody [NBP1-86184] - Staining of human cell line U-2 OS shows positivity in cytoplasm.