OIP5 Antibody
| Name | OIP5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13688 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMD IQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | OIP5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | OIP5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: OIP5 Antibody [NBP2-13688] - Analysis in human cell line HEK 293.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14545_OIP5-Antibody-Western-Blot-NBP2-13688-img0008.jpg)
Western Blot: OIP5 Antibody [NBP2-13688] - Analysis in human cell line HEK 293.
![Immunocytochemistry/Immunofluorescence: OIP5 Antibody [NBP2-13688] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14546_OIP5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13688-img0009.jpg)
Immunocytochemistry/Immunofluorescence: OIP5 Antibody [NBP2-13688] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts and in leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14547_OIP5-Antibody-Immunohistochemistry-Paraffin-NBP2-13688-img0007.jpg)
Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts and in leydig cells.