GAT-1/SLC6A1 Antibody

Name GAT-1/SLC6A1 Antibody
Supplier Novus Biologicals
Catalog NBP1-89802
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:IYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPG
Purity/Format Immunogen affinity purified
Blocking Peptide GAT-1/SLC6A1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SLC6A1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.