GERP Antibody
| Name | GERP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89776 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GERP Protein |
| Description | Rabbit Polyclonal |
| Gene | TRIM8 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GERP Antibody [NBP1-89776] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/24334_GERP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89776-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GERP Antibody [NBP1-89776] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & vesicles.
![Immunohistochemistry-Paraffin: GERP Antibody [NBP1-89776] - Immunohistochemical staining of human skeletal muscle shows cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/24335_GERP-Antibody-Immunohistochemistry-Paraffin-NBP1-89776-img0001.jpg)
Immunohistochemistry-Paraffin: GERP Antibody [NBP1-89776] - Immunohistochemical staining of human skeletal muscle shows cytoplasmic positivity in myocytes.
![Western Blot: GERP Antibody [NBP1-89776] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29400_GERP-Antibody-Western-Blot-NBP1-89776-img0006.jpg)
Western Blot: GERP Antibody [NBP1-89776] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4