SH3BGRL3 Antibody
| Name | SH3BGRL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89502 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SH3BGRL3 Protein |
| Description | Rabbit Polyclonal |
| Gene | SH3BGRL3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SH3BGRL3 Antibody [NBP1-89502] - Analysis in human cell line U-87 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25926_SH3BGRL3-Antibody-Western-Blot-NBP1-89502-img0006.jpg)
Western Blot: SH3BGRL3 Antibody [NBP1-89502] - Analysis in human cell line U-87 MG.
![Immunohistochemistry-Paraffin: SH3BGRL3 Antibody [NBP1-89502] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25927_SH3BGRL3-Antibody-Immunohistochemistry-Paraffin-NBP1-89502-img0007.jpg)
Immunohistochemistry-Paraffin: SH3BGRL3 Antibody [NBP1-89502] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
![Immunohistochemistry-Paraffin: SH3BGRL3 Antibody [NBP1-89502] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25928_SH3BGRL3-Antibody-Immunohistochemistry-Paraffin-NBP1-89502-img0002.jpg)
Immunohistochemistry-Paraffin: SH3BGRL3 Antibody [NBP1-89502] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.