GRSF1 Antibody
| Name | GRSF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89488 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GRSF1 Protein |
| Description | Rabbit Polyclonal |
| Gene | GRSF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GRSF1 Antibody [NBP1-89488] - Analysis in human cell line MOLT-4.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6499_GRSF1-Antibody-Western-Blot-NBP1-89488-img0007.jpg)
Western Blot: GRSF1 Antibody [NBP1-89488] - Analysis in human cell line MOLT-4.
![Immunocytochemistry/Immunofluorescence: GRSF1 Antibody [NBP1-89488] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6500_GRSF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89488-img0008.jpg)
Immunocytochemistry/Immunofluorescence: GRSF1 Antibody [NBP1-89488] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
![Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells and strong immunoreactivity in islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6501_GRSF1-Antibody-Immunohistochemistry-Paraffin-NBP1-89488-img0006.jpg)
Immunohistochemistry-Paraffin: GRSF1 Antibody [NBP1-89488] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells and strong immunoreactivity in islets of Langerhans.