hnRNP-R Antibody
| Name | hnRNP-R Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89676 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | hnRNP-R Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HNRNPR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: hnRNP-R Antibody [NBP1-89676] - Analysis in human cell line HEK 293.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25988_hnRNP-R-Antibody-Western-Blot-NBP1-89676-img0006.jpg)
Western Blot: hnRNP-R Antibody [NBP1-89676] - Analysis in human cell line HEK 293.
![Immunocytochemistry/Immunofluorescence: hnRNP-R Antibody [NBP1-89676] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25989_hnRNP-R%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89676-img0007.jpg)
Immunocytochemistry/Immunofluorescence: hnRNP-R Antibody [NBP1-89676] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining of human cerebral cortex shows strong nuclear positivity in glial and neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25990_hnRNP-R-Antibody-Immunohistochemistry-Paraffin-NBP1-89676-img0004.jpg)
Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining of human cerebral cortex shows strong nuclear positivity in glial and neuronal cells.