Adenylate Cyclase 8 Antibody
| Name | Adenylate Cyclase 8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90278 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Adenylate Cyclase 8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADCY8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 8 Antibody [NBP1-90278] - Staining of human cell line U-251MG shows positivity in nucleus, nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6460_Adenylate%2520Cyclase%25208%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90278-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Adenylate Cyclase 8 Antibody [NBP1-90278] - Staining of human cell line U-251MG shows positivity in nucleus, nucleoli and cytoplasm.
![Immunohistochemistry-Paraffin: Adenylate Cyclase 8 Antibody [NBP1-90278] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6461_Adenylate%2520Cyclase%25208%2520Antibody-Immunohistochemistry-Paraffin-NBP1-90278-img0002.jpg)
Immunohistochemistry-Paraffin: Adenylate Cyclase 8 Antibody [NBP1-90278] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.