C1orf106 Antibody
| Name | C1orf106 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90424 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PPQTLEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSESSSPATTPQDGPSASSLWLLEPASYHVVPIRG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C1orf106 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C1orf106 |
| Supplier Page | Shop |
Product images
![Western Blot: C1orf106 Antibody [NBP1-90424] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/24925_C1orf106-Antibody-Western-Blot-NBP1-90424-img0006.jpg)
Western Blot: C1orf106 Antibody [NBP1-90424] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: C1orf106 Antibody [NBP1-90424] - Staining of human cell line U-251MG shows positivity in cytoplasm & golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/24926_C1orf106-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90424-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C1orf106 Antibody [NBP1-90424] - Staining of human cell line U-251MG shows positivity in cytoplasm & golgi apparatus.
![Immunohistochemistry-Paraffin: C1orf106 Antibody [NBP1-90424] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/24927_C1orf106-Antibody-Immunohistochemistry-Paraffin-NBP1-90424-img0002.jpg)
Immunohistochemistry-Paraffin: C1orf106 Antibody [NBP1-90424] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
![Simple Western: C1orf106 Antibody [NBP1-90424] - Simple Western lane view shows a specific band for C1orf106 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/22850_C1orf106-Antibody-Simple-Western-NBP1-90424-img0007.jpg)
Simple Western: C1orf106 Antibody [NBP1-90424] - Simple Western lane view shows a specific band for C1orf106 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.